Predicted Species Reactivity:Human, Mouse, RatClonality:PolyclonalHost:RabbitApplication:IHC, IF, ELISAAdditional Information:Modification Sites: Human:S910 Mouse:S948 Rat:S913Reconstitution and Storage:Stable at -20C for at least 1 year.Gene Symbol:PTK2NCBI Gene Id:5747Swissprot Id:Q05397Alias Symbols:FADK 1, FAK1, Focal adhesion kinase 1, pp125FAK, Protein- tyrosine kinase 2, PTK2Replacement Item:This antibody may replace item sc-1688 from Santa Cruz Biotechnology.Molecular Weight:119 kDaPurification:The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.Tissue Tool:Find tissues and cell lines supported by DNA array analysis to express PTK2. 
RNA Seq:Find tissues and cell lines supported by RNA-seq analysis to express PTK2. 
Immunogen:The antiserum was produced against synthesized peptide derived from human FAK around the phosphorylation site of Ser910.Peptide Sequence:Synthetic peptide located within the following region: PPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYConcentration:1mg/mlDatasheets/Manuals:Printable datasheet for OAAF07560Specificity:FAK (Phospho-Ser910) Antibody detects endogenous levels of FAK only when phosphorylated at Ser910.